Protein Info for Rru_A3226 in Rhodospirillum rubrum S1H

Annotation: putative enoyl-acyl carrier protein reductase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13561: adh_short_C2
  • amino acids 16 to 254 (239 residues), 290.5 bits, E=1.1e-90
• PF00106: adh_short
  • amino acids 19 to 200 (182 residues), 70.9 bits, E=1.1e-23

Best Hits

Swiss-Prot: 45% identical to FABI1_RHIME: Enoyl-[acyl-carrier-protein] reductase [NADH] 1 (fabI1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00208, enoyl-[acyl-carrier protein] reductase I [EC: 1.3.1.9] (inferred from 100% identity to rru:Rru_A3226)

MetaCyc: 44% identical to enoyl-(acyl-carrier-protein) reductase [NADH] (Agrobacterium fabrum C58)
Enoyl-[acyl-carrier-protein] reductase (NADH). [EC: 1.3.1.9]

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.3.1.9)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• fatty acid elongation -- saturated (4/5 steps found)
• 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• biotin biosynthesis I (8/15 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (26/205 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.9

Use Curated BLAST to search for 1.3.1.9

Sequence Analysis Tools

See Q2RPC4 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Rru_A3226 putative enoyl-acyl carrier protein reductase (NCBI) (Rhodospirillum rubrum S1H)
MDTPFSLRGKKGLVVGIANDQSIAFGCARYFKKMGADIAVTYLNEKAKPYVEPLAGDLDA
LLLGPCDVRESGQLKGVFDRIAEEWGQLDFFLHSIAFAPKEDLHAPVIDCSREGFSLAMD
VSCHSFVRMAKYAEPLMKNGGSMLTVTFYGGLKVVEHYNMMGPVKAALEGVTRYLAADLG
PKGIRVNAISPGPLRTRAASGLDRFDELLEAAAKRAPQHQLVTIDDCGALAAFLVGDGAK
AMTGATYFVDGGYNIMG