Protein Info for Rru_A3222 in Rhodospirillum rubrum S1H

Annotation: transport system permease protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 203 to 217 (15 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 263 to 290 (28 residues), see Phobius details amino acids 302 to 320 (19 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details PF01032: FecCD" amino acids 31 to 350 (320 residues), 274.6 bits, see alignment E=1e-85 PF00950: ABC-3" amino acids 136 to 314 (179 residues), 21.4 bits, see alignment E=1.7e-08

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to rru:Rru_A3222)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPC8 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Rru_A3222 transport system permease protein (NCBI) (Rhodospirillum rubrum S1H)
MPKGLHPPLSRPFRLGRAIPRTALGGALCLVVTLTLISFAIGPYGVAPGKVLAILASRAL
PGLAQALSLSWTPEDEVVVMAIRLPRILGALLVGAALATSGATFQGLFRNPLVSPDLLGA
AAGAGCAAAAGLLLGLGGPAIQGLAFLGGLAAVGLTCLIAKGRGGAGDGPLMMVLTGLIV
GTVFSAFIGLIKTLADPDNTLPAITFWLMGSLSAITLDDIALAAPPIGCGVGLACLLRWR
LNALAFGDDEARALGIDVGRVRLAAIVAATLMTAAAVAIAGIIGLVGLVVPHMTRMLLGP
NHAVLLPACALLGGAFLLGVDDLARSLGPTEIPLGILTALIGAPLFLALLPGARRGWR