Protein Info for Rru_A3210 in Rhodospirillum rubrum S1H

Annotation: DNA methylase N-4/N-6 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF01555: N6_N4_Mtase" amino acids 27 to 248 (222 residues), 220.2 bits, see alignment E=5.4e-69 PF18755: RAMA" amino acids 266 to 362 (97 residues), 58.5 bits, see alignment E=9e-20

Best Hits

Swiss-Prot: 65% identical to MTC1_CAUVN: Modification methylase CcrMI (ccrMIM) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K13581, modification methylase [EC: 2.1.1.72] (inferred from 100% identity to rru:Rru_A3210)

Predicted SEED Role

"Modification methylase"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPE0 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Rru_A3210 DNA methylase N-4/N-6 (NCBI) (Rhodospirillum rubrum S1H)
MTDPLRTNRIYQGDSIEVMRSLPSASIDMIFADPPYNMMLGGELLRPDNSRVDGVDDEWD
RFESQRAYAEFTRSWLREARRLLKDNGTIWVIGSYHNIYRVGAELQDLGFWTLNDVVWRK
ANPMPNFKGTRFTNAHETLLWCAKSAEARYTFNYEAMKSLNEGLQMRSDWTLPLCNGKER
LKAEDGKKVHPTQKPESLLYRVILSSTHPGDIILDPFFGTGTTGAVAKLLGRQWIGLERD
EAYIAAARQRIAQVEPIKDLRLLITPSKKSEPRIPFGTVVERGLLAPGSLLCDSQRRWTA
KVRADGTLVATSSHGDHRGSIHQVGAAVQGAPACNGWTFWHIDRPGGAVPIDVLRQQVRA
ELEACAL