Protein Info for Rru_A3200 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 197 to 226 (30 residues), see Phobius details amino acids 256 to 280 (25 residues), see Phobius details amino acids 311 to 335 (25 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details amino acids 428 to 449 (22 residues), see Phobius details amino acids 481 to 505 (25 residues), see Phobius details amino acids 537 to 560 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 89 to 268 (180 residues), 46.5 bits, see alignment E=1.9e-16 amino acids 380 to 561 (182 residues), 47.6 bits, see alignment E=8.2e-17

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 100% identity to rru:Rru_A3200)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPF0 at UniProt or InterPro

Protein Sequence (574 amino acids)

>Rru_A3200 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MIVPRALSRRLPSRLTSESLLLGGATLYVAVFCLLPLLRLLAEPLAADTGGGWQMVVRVL
GARATTTAFWNTLEAGLASTLLAVVVGGGLAIVVGLTTVRARGLLTFICLIPLLIPAQIA
ALAWLELAGPNSPLLRLIGLGVATGQRNPLYSAGGVIWLLGLEHAPMVFLAARAGLRALP
NDLVEAARMAGARGPRIVLTIVLPLLRPALLAGAALAFVSAIGNFGVSALLGIPGRFPML
TTLIYRRLNGFGPDVLAEVAVLAMILAGLAGAGLLLQAWAWGRQNRHAARDTAALAPLPL
GRWRLLVEGGLWLFLGLTALMPLAALTGAALAPALGVATTWDSATLDHFRAVFANPVMLR
ALTNSFTLATVAGGVGLVVAAPLAYFIVTRRAPLARALNYIADMPYALPGIILSISCILL
YLKPLPGLGIGLYNSFWILLVAYLGRFLALSLRPAMAGVAQIDPALEEAARVAGAGPMAR
FFAIVLPLAAPAAAAGGLLVFLAAFNELTVSALLWSAGHETLGVMVFSLTDEGNSNAAAA
VSVIAVLATLAVALAATVFARAARLPKGVLPWQD