Protein Info for Rru_A3192 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF205 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 62 to 88 (27 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 127 to 152 (26 residues), see Phobius details amino acids 158 to 191 (34 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 15 to 210 (196 residues), 171.9 bits, see alignment E=7.2e-55 PF02660: G3P_acyltransf" amino acids 20 to 200 (181 residues), 170.6 bits, see alignment E=1.5e-54

Best Hits

Swiss-Prot: 100% identical to PLSY_RHORT: Glycerol-3-phosphate acyltransferase (plsY) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 100% identity to rru:Rru_A3192)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPF8 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Rru_A3192 Protein of unknown function DUF205 (NCBI) (Rhodospirillum rubrum S1H)
MADLSTLMPALVLGVCALAGYLLGSVPFGLVLVRLAGLGDVRGIGSGNIGATNVLRTGRK
DLALATLVLDSGKGAIAALVASALASRIAGFEDAVLAGLLAGGMAVVGHNFPIWLGFKGG
KGVATTLGTLLATAWPVGLAACATWLVVAALFRYSSLAALVCLALAPAYALVLATPAHAA
VFALLALLAWIRHRANIARLLKGEESRIGAKKKAAP