Protein Info for Rru_A3191 in Rhodospirillum rubrum S1H

Annotation: Dihydroorotase multifunctional complex type (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 TIGR00857: dihydroorotase, multifunctional complex type" amino acids 29 to 428 (400 residues), 343.6 bits, see alignment E=8.2e-107 PF01979: Amidohydro_1" amino acids 60 to 427 (368 residues), 71.5 bits, see alignment E=7.8e-24 PF07969: Amidohydro_3" amino acids 234 to 428 (195 residues), 40.4 bits, see alignment E=2.9e-14

Best Hits

Swiss-Prot: 45% identical to PYRC_ANAPZ: Dihydroorotase (pyrC) from Anaplasma phagocytophilum (strain HZ)

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 100% identity to rru:Rru_A3191)

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.3

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPF9 at UniProt or InterPro

Protein Sequence (432 amino acids)

>Rru_A3191 Dihydroorotase multifunctional complex type (NCBI) (Rhodospirillum rubrum S1H)
MSLRSPGRVAYVNARLLDPASGLDQTGALLADGEHIVEVHPGAFTAPEDAEIIDCQGACL
APGLVDMRVQLREPGEEHKESMRSAGQAAVAGGITSMVCLPNTNPPMDDEATLEFVARRA
RLAGLAKVYCYGACTKGLRGEDLAELGIMAEAGALAFTDGVKAIANAQMMRRVLAYAATF
DLLVMQHPEEPTLAGGVMNAGDLATRMGLSGIPREAEIILLERDLRLVAMTGGRYHAAHI
STGESVALIRRAKDQGLRVSCDTAPFYFALNELAVGDYRTFAKLSPPLRGESDRRAIIEG
LKDGVIDAIASDHSPQDQDTKRLPFAQAAFGAVGLETLLSISLELHHNGHLSLLEVLKRL
TVAPAGLLGLDAGRLRPGGKADLLVFDPYRAGKVDATRFLSKSKNSPFDDRPVQGRVLRT
VVDGRTVFPANG