Protein Info for Rru_A3174 in Rhodospirillum rubrum S1H

Annotation: Major facilitator superfamily MFS_1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 334 to 360 (27 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 344 (328 residues), 51.6 bits, see alignment E=3.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3174)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPH6 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Rru_A3174 Major facilitator superfamily MFS_1 (NCBI) (Rhodospirillum rubrum S1H)
MPPIAPRSARALAPFAITLITFVGAASAPSPLYGLYQKAWGFSSLTLTAIFAVYAGALLL
TLLITGSLSDHLGRRPVILSAIVLEIIAMALFSRAEGVSWLIAARLTQGVATGLATAALG
AALIDIERTRGTLTNTVGSLAGMAIGALATATLIQLAPTAGDLVFPILMAIFIGEGLWIA
AQSEPATPRPGAWASLKPSVGLPRAARRTFLLVAPIDIAIWALGGFYLSLGPALARGIAT
TPLPILGGLAIFALAMTGAGAIVVFNSLSPHRQIVLGAASMAGGVALTLLAAHGGGLALF
FGGTVLAGIGFGVGFQGAVRSVMPLAGAGERAGLLAALYILSYASNSLPALAAGGLVGSF
GLARVGDVYGGLVVALSLLALAGALVFPARSCGAGGKEAGPVSPEVSRAGCR