Protein Info for Rru_A3168 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 145 to 171 (27 residues), see Phobius details amino acids 191 to 225 (35 residues), see Phobius details amino acids 260 to 285 (26 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 161 to 341 (181 residues), 104.2 bits, see alignment E=3.6e-34

Best Hits

Swiss-Prot: 61% identical to YEJE_ECOLI: Inner membrane ABC transporter permease protein YejE (yejE) from Escherichia coli (strain K12)

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 100% identity to rru:Rru_A3168)

MetaCyc: 61% identical to putative oligopeptide ABC transporter membrane subunit YejE (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPI2 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Rru_A3168 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MVALLTLTPLTRRRLAAFRRNRRGFHSLWIFLTLFIISLGAELVANDKPLVLSYKGDLYF
PVLKDYPETTFGGFFPTTADYRDPYVAEAIANDGWTVWPPVRFAYDTVNRTLDRPVPSAP
TWDNPLGTDDQGRDVFARLLYGFRLSVLFGLALTALSSLIGVAAGAVQGYFGGWIDLLAQ
RVLEIWGGLPQLFVLIIVASVIQPGFWTLLLILLLFSWTALVGVVRAEFLRGRNFDYVRA
AKALGMSDTKIMIKHVLPNAMVATLTFAPFILSGSVTALTALDFLGLGMPPGSPSLGELL
RVGKENLQAPWLGFTGFIVLAAMLTLLVFIGEAVRDAFDPRKGADR