Protein Info for Rru_A3163 in Rhodospirillum rubrum S1H

Annotation: 3-deoxy-D-manno-octulosonate cytidylyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR00466: 3-deoxy-D-manno-octulosonate cytidylyltransferase" amino acids 27 to 259 (233 residues), 191.3 bits, see alignment E=8.9e-61 PF02348: CTP_transf_3" amino acids 27 to 240 (214 residues), 140.3 bits, see alignment E=8.1e-45 PF12804: NTP_transf_3" amino acids 36 to 147 (112 residues), 30.6 bits, see alignment E=3.8e-11

Best Hits

Swiss-Prot: 100% identical to KDSB_RHORT: 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00979, 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC: 2.7.7.38] (inferred from 100% identity to rru:Rru_A3163)

Predicted SEED Role

"3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38)" in subsystem KDO2-Lipid A biosynthesis (EC 2.7.7.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPI7 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Rru_A3163 3-deoxy-D-manno-octulosonate cytidylyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MIGASAVSASRDPTMTQSPSLAAAAPIVVIPARMASTRLPGKPLADIHGVPMIVQVWRRA
MEAGIGPVLVAAAEDEIAQAVRAAGGNAVLTDPDLPSGSDRVWQAVERFDPAGRHAVVVN
VQGDLPTLDPGLIIRAVETVLAEPDIALSTLICEITREEERTNPNVVKAVVGLAEGQTRG
RALYFSRATVPHGPGPHYHHIGLYAYRRTTLGAFVSLPPGVLERREKLEQLRALENHMRI
EAALVDTVPLGVDTAEDLERARALLG