Protein Info for Rru_A3162 in Rhodospirillum rubrum S1H

Annotation: Prephenate dehydratase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K04518, prephenate dehydratase [EC: 4.2.1.51] (inferred from 100% identity to rru:Rru_A3162)

Predicted SEED Role

"Prephenate dehydratase (EC 4.2.1.51)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 4.2.1.51)

MetaCyc Pathways

superpathway of aromatic amino acid biosynthesis (18/18 steps found)
superpathway of L-phenylalanine biosynthesis (10/10 steps found)
L-phenylalanine biosynthesis I (3/3 steps found)
L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
superpathway of chorismate metabolism (37/59 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPI8 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Rru_A3162 Prephenate dehydratase (NCBI) (Rhodospirillum rubrum S1H)
MSDPNQTVAFQGLPGAYSHMAATRLFPAMDVLPCAAFDDAFAAVREGKALYAVLPIENSV
AGRVADIHHLMPDSGLHIIGEYFLKVNHHLLAPEGAKIEDIRIVRSHVHALGQCRRFIKA
HGLKAIVHADTAGAAAELAERKAPGEAAIASELAGRIYGLSSLHANIEDENHNTTRFLIM
AREAVQPREDVAAVTTFVFRVRNVPAALYKALGGFATNGINMTKLESYQVAGTFVAARFY
ADVEGRPDQPALARALDELRHFTHELLILGVYPAHPYRFAARQSLTPE