Protein Info for Rru_A3142 in Rhodospirillum rubrum S1H

Annotation: Type III effector Hrp-dependent outers (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF07005: SBD_N" amino acids 4 to 230 (227 residues), 263 bits, see alignment E=2.8e-82 PF17042: NBD_C" amino acids 257 to 414 (158 residues), 133.6 bits, see alignment E=1e-42

Best Hits

Swiss-Prot: 58% identical to OTNK_CUPNH: 3-oxo-tetronate kinase (otnK) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3142)

MetaCyc: 58% identical to 3-dehydrotetronate 4-kinase monomer (Cupriavidus necator H16)
RXN-18594 [EC: 2.7.1.217]; 2.7.1.217 [EC: 2.7.1.217]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.217

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPK8 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Rru_A3142 Type III effector Hrp-dependent outers (NCBI) (Rhodospirillum rubrum S1H)
MPLLGCIADDFTGATDLAAMLVGNGMRTVLMLGRPKAATESPKADAVVVALKSRTTPAAQ
AVSDSLDALTWLRAAGARQIVFKYCSTFDSTAQGNIGPVADALAEALETDFALVCPAFPA
NGRTVYQGHLFVGDHLLNESGMRDHPLTPMRDASVVRLLAAQTPHRVGLIALPVVEAGVP
AIDEALRALRATGVRYGVIDALTDDHLRTIGAAAAGHRLITGGSGVAMGLPENFRRQGLL
PFRDDSASLPKVDGGAAVLVGSCSQATRQQVAQARPHLPTLILDPLATPEAGALMAIARA
WIDAQPAGAPLMIVGSAAPEAVAALQKRLGAGPAGALIETVLAGLAEDLVERGIRSLVVA
GGETSGAVVSRLGITSLRVGAEIAPGVPWTLADHPAGPLRLALKSGNFGSATFFLEALGL
PL