Protein Info for Rru_A3135 in Rhodospirillum rubrum S1H

Annotation: Orn/DAP/Arg decarboxylase 2 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03099: pyridoxal-dependent decarboxylase, exosortase A system-associated
  • amino acids 10 to 404 (395 residues), 592.3 bits, E=2.4e-182
• PF00278: Orn_DAP_Arg_deC
  • amino acids 35 to 382 (348 residues), 44.6 bits, E=1.5e-15
• PF02784: Orn_Arg_deC_N
  • amino acids 42 to 286 (245 residues), 95.5 bits, E=3.5e-31

Best Hits

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 100% identity to rru:Rru_A3135)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.20

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

See Q2RPL5 at UniProt or InterPro

Protein Sequence (404 amino acids)

>Rru_A3135 Orn/DAP/Arg decarboxylase 2 (NCBI) (Rhodospirillum rubrum S1H)
MTASPPPGFGVSGSDLTIGGQRVSHLARIAGGTPFYAYDRGAVSARIAALRAALPAGMAI
RYSLKANPMAALLAHMAPLVDGFDAASAGELRAGLAVGMAPAALSIAGPGKSPADILSAV
AAGALVVVESLAEVGRVAQAGNASGLRPRVLVRVNPEAEIQGAGLRMGGGARPFGIDADQ
VPGVLAAIAAHDLDYQGLHCFWGSQALDAERIARAFAVVGQTLLDLAGPRPPRQIVIGGG
FGIPYTPTSAPLDLARAGAAVAETAGLLGDHLPGVSLGLELGRFLVGEAGVYVCAIRESK
RSRGNLFLVTDGGLHHNQAATGNFGQVVRRPYPLVIATRMGEPVSERATITGCLCTPLDV
FAEALAIPAAAEGDLVAIFQSGAYGASASPSAFLGHPPAVELLV