Protein Info for Rru_A3120 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 226 to 251 (26 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 313 to 330 (18 residues), see Phobius details TIGR03109: exosortase A" amino acids 24 to 287 (264 residues), 302.5 bits, see alignment E=4.8e-94 TIGR02602: exosortase" amino acids 53 to 283 (231 residues), 160.7 bits, see alignment E=8.9e-51 PF09721: Exosortase_EpsH" amino acids 53 to 280 (228 residues), 196.3 bits, see alignment E=5.5e-62 TIGR04178: exosortase/archaeosortase family protein" amino acids 192 to 287 (96 residues), 65.1 bits, see alignment E=1.1e-21 PF11984: DUF3485" amino acids 315 to 505 (191 residues), 87.3 bits, see alignment E=1.1e-28 TIGR02914: EpsI family protein" amino acids 343 to 514 (172 residues), 133.5 bits, see alignment E=1.1e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3120)

Predicted SEED Role

"Eight transmembrane protein EpsH / EpsI protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPN0 at UniProt or InterPro

Protein Sequence (523 amino acids)

>Rru_A3120 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MNRGREPLVATAPLAPRWAIGGADASALALGTAICLGIFLLFFETFGSMIGLWATIADYH
HSFAVIPCALWLGWERRDLVRGVAFAPWPLAFLAVVGAALLWLAGRLGSVQFVEHLGVIL
LLQSALIAALGQGFAKAMALPLAFLIFLLPIGDALIPSLQAITASLAANGLALFDVPVFH
DGVFLITPFGNFEVAQECSGLRFLVATLTFGAVISAVVHRSAWRRALFLLSCAIVPVLAN
GLRVIGIILLARHAGHETAAAFDHVIYGWVFLSLVSVFIFALGWLTREPPRPLRRKGAHP
PSSARPLRPLRTGIAVLALAATPVAANAAIETSLAGRLAPAALILPAPGPASTADPLWTP
QIPGADLVDHRAFLIGGRAVDRVIAYFTHQRQGAEAVSATIDPAGLEMVSQGERVVALTD
PVAGLAAVRERVIAGPGRQRLVWSWLWVGGHFTTDAKAAKIFQVLGVLPGGQPAAALVMI
SVPLAAAPASPQALDDARALLGRFLAGQGDLGPGLALAQEKDR