Protein Info for Rru_A3105 in Rhodospirillum rubrum S1H

Annotation: glycosyl transferases group 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 73 to 90 (18 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details TIGR03087: sugar transferase, PEP-CTERM/EpsH1 system associated" amino acids 4 to 398 (395 residues), 589.5 bits, see alignment E=1.8e-181 PF13692: Glyco_trans_1_4" amino acids 227 to 364 (138 residues), 104.6 bits, see alignment E=2.8e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3105)

Predicted SEED Role

"FIG137776: Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPP5 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Rru_A3105 glycosyl transferases group 1 (NCBI) (Rhodospirillum rubrum S1H)
MADILFLCQRIPFPPTKGDKIRSFHILDHLARRHRIHLGTFVDDPEDRGFEADLKRYCAD
ALVLPLDRRVATGRALLALPSATPLSIAFYRDRRMQRWVDGVLARRPAAAFLFSSAMAQY
VVGHPAAPPRVVMDFVDVDSEKWAAYARDRQGPRRWVYAREAKRLLAYDRQIAARVDASL
FVSQAEADLFGTLAPESAGRIHPLSNGIDTVFFDPTLTYADPYSPGKPVLVFTGAMDYEP
NVKAVCWFASQVLPLVRAARPAAEFWIVGANPASAVRALDRHPGVTVTGRVADIRPYLAH
ADVAVAPMFLGRGIQNKVLEAMAMARPTVVSAEAVEGIGAGDGAELLVAPLSPRGFADAT
LEALAPGAAALGQRARRYLLDAFAWERTIAPLGACLGLP