Protein Info for Rru_A3102 in Rhodospirillum rubrum S1H

Annotation: sugar transferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 16 to 41 (26 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details amino acids 452 to 469 (18 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 19 to 474 (456 residues), 442.2 bits, see alignment E=2.9e-136 TIGR03013: sugar transferase, PEP-CTERM system associated" amino acids 20 to 475 (456 residues), 658.2 bits, see alignment E=6.9e-202 PF02397: Bac_transf" amino acids 287 to 469 (183 residues), 219.4 bits, see alignment E=1.4e-69

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3102)

Predicted SEED Role

"FIG071646: Sugar transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPP8 at UniProt or InterPro

Protein Sequence (483 amino acids)

>Rru_A3102 sugar transferase (NCBI) (Rhodospirillum rubrum S1H)
MIKILGHHISTLSITLALYETLIFMCVLYSFIFIMSFFFNIPVPEKLSMVILLALTATIA
AGSLGLYNQRLFGDFKEFIWRIALTLPLILLAVLFVSFAYGEITATDQSPFYLAAAFGIP
AALLLVVLGRGICFRIPGIKAFRRRILVLGTGEMADRLAALETSQPYRHYEIIGFVALGD
DPAPLGEKWRVFDRNCIETRHDLLKICADHNINEVIFAASERRRANSSTFGLPVWDLLEC
RLMGIHVAEYASFWERETGRIDLDHLRPGWLIFSEGFRNSSRRMIAKRFFDVITALLLVI
LSLPVLVAAAIAVKLSSPGPVFYRQERVGVNGKPFNLIKFRSMPIDAEKNGPVWGTVKDK
RATGVGSLLRRTRIDEIPQVFNVLRGDMSFIGPRPERPVFVEELSRELDFYGERHAVRPG
ISGWAQINYPYGASVADAKQKLSYDLYYIKNGSLFLDIIILFQTFRVVLWPEGSKEKAGA
VVR