Protein Info for Rru_A3093 in Rhodospirillum rubrum S1H

Annotation: Membrane protein involved in the export of O-antigen and teichoic acid-like (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 88 to 114 (27 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 309 to 333 (25 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details amino acids 435 to 460 (26 residues), see Phobius details amino acids 466 to 487 (22 residues), see Phobius details PF13440: Polysacc_synt_3" amino acids 40 to 343 (304 residues), 55.9 bits, see alignment E=2.1e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3093)

Predicted SEED Role

"O-antigen flippase Wzx" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPQ7 at UniProt or InterPro

Protein Sequence (507 amino acids)

>Rru_A3093 Membrane protein involved in the export of O-antigen and teichoic acid-like (NCBI) (Rhodospirillum rubrum S1H)
MTGGGAKGRALVVGAALAMVAFVVEVVSAFFLMPFLIHALGPERYGLWALIGTIIAQFSL
LDFGLSATAQRYMAGALAQDDRARAGEIFSAAALLFLIAGGVAFALSLILAGGAPLVMAP
GPGRDEFALALAIMGGMVGLSLPLNVVRGTVMARMSFAWLSVIEIGRALLRVGAVVLVID
QGRGLAALAAITLAITVLEAAALRLLLARVLPWLSVRPGGVRRATLIELFHFSKHVFVVK
IGDMARYRMDNFIIAPVLGLSAVTHYSAASRLADTFISLIDRVFTLCGPVFSGYAALDDR
ENMREKFLLFTRFATLATACAAGGVLSAGWIFIPLWLGPEFIDSYHAMAALTVGLTALLI
QAPTREVLSALYKHPFDAWTNLAEAVANLAISLLLVGDFGILGVALGTAIPMVVVKMGVL
PVYACRRIGLGVGTYYRLVAGALAVVALCHLPIVAVMVSIPHSFPALFTAALVCYGLLGM
VLFRFALPREIRALLLASLRPARVAAV