Protein Info for Rru_A3074 in Rhodospirillum rubrum S1H

Annotation: 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family-like (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 119 to 146 (28 residues), see Phobius details amino acids 165 to 198 (34 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 243 to 268 (26 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 351 to 369 (19 residues), see Phobius details PF13231: PMT_2" amino acids 71 to 226 (156 residues), 80.2 bits, see alignment E=1e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3074)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPS6 at UniProt or InterPro

Protein Sequence (513 amino acids)

>Rru_A3074 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family-like (NCBI) (Rhodospirillum rubrum S1H)
MDAPWIQCATGTADRGRALLYSRWVGLAVLCLLCLVRLLLSAGGTIPPHPDEAMLWAAGQ
PLGAVLGGDHPLVSLILSASVELLGNTVFALRAPGVIALGLASIAVWRLAGLLYDARVAF
WAAVVFATLPVVSYASAIAGTAGFLPLFWAVALHGLLRGLKSDSLVWWLVLGTAFGLGLL
TDGAMALLVPCFLLYGLLSPEYHALWRRRGLWLALGLGLAIAAPAFWAGLLHADLTPQPT
PAAGFAFLVAQVAVFGPIPATVLAWVALHPGGGAMIGGYGPGDERRAADERARRGYRIRF
FLSFSLPVVALATLAAAMGGALPAEAAAVAYVGGAILVASWLLTTPLRRGLLRLCVALHI
LGALLFFNLDGLLRDSGLRPPAGLDPFADLRGMDRVAVWGGELAARYPGVPMIFDDPGIL
ASLRFQSHPRSTVMVLASALGGADAIGLGPAPNGILVITRAPTGPDTPTPDTPAADTSND
EGGRDAGFVDIEAVPGRWISLRARFLPPAGEQP