Protein Info for Rru_A3066 in Rhodospirillum rubrum S1H

Annotation: NAD(P)H dehydrogenase (quinone) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF02525: Flavodoxin_2" amino acids 1 to 168 (168 residues), 153 bits, see alignment E=8.6e-49 PF03358: FMN_red" amino acids 1 to 109 (109 residues), 52.6 bits, see alignment E=4e-18

Best Hits

KEGG orthology group: K00355, NAD(P)H dehydrogenase (quinone) [EC: 1.6.5.2] (inferred from 100% identity to rru:Rru_A3066)

Predicted SEED Role

"NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2" (EC 1.6.99.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2, 1.6.99.-

Use Curated BLAST to search for 1.6.5.2 or 1.6.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPT4 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Rru_A3066 NAD(P)H dehydrogenase (quinone) (NCBI) (Rhodospirillum rubrum S1H)
MHALIVVAHPDQTSLTHAVAQQVAQGLTAAAAGHSVELADLAAEGFDPRFTEADLAFFHK
RADSPVDIAAEHARLDRADALVLVYPLYWWSFPALLKGWIDRVFTNGWAYEEEEGGKVIK
KLRRLEVHLIAIGGADQRTIARHGYVDAMKTQIDHGIFGYCGPRVVTSDLMLASDPGFPR
AHLDAAEVIGSRIFSSRS