Protein Info for Rru_A3063 in Rhodospirillum rubrum S1H

Annotation: Crotonyl-CoA reductase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 327 to 345 (19 residues), see Phobius details TIGR01751: crotonyl-CoA carboxylase/reductase" amino acids 30 to 419 (390 residues), 609.7 bits, see alignment E=9.6e-188 PF08240: ADH_N" amino acids 64 to 178 (115 residues), 57.3 bits, see alignment E=2.6e-19 PF00107: ADH_zinc_N" amino acids 222 to 364 (143 residues), 65.8 bits, see alignment E=5.9e-22 PF13602: ADH_zinc_N_2" amino acids 300 to 402 (103 residues), 27.5 bits, see alignment E=8.3e-10

Best Hits

Swiss-Prot: 79% identical to CCR_RHOS4: Crotonyl-CoA reductase (ccr) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K14446, crotonyl-CoA carboxylase/reductase (inferred from 100% identity to rru:Rru_A3063)

MetaCyc: 78% identical to crotonyl-CoA carboxylase/reductase monomer (Methylorubrum extorquens AM1)
RXN-18384 [EC: 1.3.1.85]; 1.3.1.85 [EC: 1.3.1.85]

Predicted SEED Role

"Crotonyl-CoA carboxylase/reductase, ethylmalonyl-CoA producing"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPT7 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Rru_A3063 Crotonyl-CoA reductase (NCBI) (Rhodospirillum rubrum S1H)
MTTSAEVIELNPGTGRKDLYELGEIPPLGHVPKSMYAWVIRRDRHGEPEKSFQVEVVETP
TLDSHDVLVMVMAAGVNYNGIWAGLGQPISVFDSHKAAYHIAGSDAAGIVWAVGAKVKRW
KVGDEVVVHCNQTDGDDEECNGGDPMFSPTQRIWGYETPDGSFAQFTRVQSQQVMARPRH
LTWEESASYVLVLATAYRMLFGHRPHVLRPGHNVLIWGASGGLGSMAIQLCATAGANAIG
VISDETKRDFVMSLGAKGVINRKDFNCWGQLPTVNGEGFDAYMKEVRKFGKAIWDITGKG
NDVDFVFEHPGEQTFPVSCNVVKRGGMVVFCAGTTGFNLTFDARFVWMRQKRIQGSHFAN
LLQASQANQLVIERRIDPCMSEVFSWDDIPKAHTKMWKNQHKPGNMAVLVQAHRPGRRTL
EDCREEG