Protein Info for Rru_A3053 in Rhodospirillum rubrum S1H

Annotation: Homoserine kinase ThrB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 TIGR00938: homoserine kinase" amino acids 1 to 306 (306 residues), 406.6 bits, see alignment E=3.5e-126 PF01636: APH" amino acids 27 to 257 (231 residues), 161.1 bits, see alignment E=2e-51

Best Hits

Swiss-Prot: 100% identical to KHSE_RHORT: Homoserine kinase (thrB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02204, homoserine kinase type II [EC: 2.7.1.39] (inferred from 100% identity to rru:Rru_A3053)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPU7 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Rru_A3053 Homoserine kinase ThrB (NCBI) (Rhodospirillum rubrum S1H)
MAVYTDVSDDDLTTFLEGYDIGRLRACKGIAEGVENSNFLLVTDRGPHILTLYEKRVNPD
DLPFFLGLLRHLAARDIPCPQPVAGRDGAVLHTLCDRPAAIVTFLDGVWPKRPEVRHCAQ
LGEALARLHLAGGDYAPTRRNSLSVDGWRPLFDAAAERADSVKPGLRAELETELDALEAL
WPHDLPTGIIHADLFPDNVFFVDDTLSGLIDFYFACDDFLAYDLAVCLNAWCFEGEREFN
VTKARHMLTRYEKVRPLSDAEFAALPLLARGAAMRFLLTRLYDWLNTPPGAMVRPKDPME
YYHKLAFHRAVSGPGAYGLSR