Protein Info for Rru_A3049 in Rhodospirillum rubrum S1H

Annotation: Glycine dehydrogenase (decarboxylating) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF02347: GDC-P" amino acids 1 to 442 (442 residues), 372.6 bits, see alignment E=2.7e-115 PF00266: Aminotran_5" amino acids 207 to 376 (170 residues), 22.6 bits, see alignment E=4.9e-09

Best Hits

Swiss-Prot: 100% identical to GCSPA_RHORT: Probable glycine dehydrogenase (decarboxylating) subunit 1 (gcvPA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00282, glycine dehydrogenase subunit 1 [EC: 1.4.4.2] (inferred from 100% identity to rru:Rru_A3049)

Predicted SEED Role

"Glycine dehydrogenase [decarboxylating] (glycine cleavage system P1 protein) (EC 1.4.4.2)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 1.4.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.4.2

Use Curated BLAST to search for 1.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPV1 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Rru_A3049 Glycine dehydrogenase (decarboxylating) (NCBI) (Rhodospirillum rubrum S1H)
MRYLPHSEADRAAMLATIGAASVEDLFRDVPREALDQAAFDALPDHGGEMEVERALSALA
ARNLTAGSVPCFLGAGSYRHHVPAAVDALIQRGEFLTSYTPYQAEVSQGTLQYLFEFQTQ
VALITGMEVANASMYDGATACAEAAAMAVRITRRRKVLMAGGLHPHYTATTQTLLACLGH
EGEGLPPDPLALGDLIGRVGSDTACVIVQNPDFFGRLRDLSPLAEACHAAGALLVVAVCE
PVSLGLVAPPGAMGADIVVAEGHALGSPTGFGGPGVGLFATREKYLRQMPGRLAGETLDE
SGKRGYVLTLSTREQHIRREKATSNICTNSGLIALAFTIHMTLLGEAGFTRLAWINHANA
VALAEKLARVKGVKVLPETFFNEFTLRLPKPAAEVVEALAARSILAGVPVSRFLPTYPEL
ANLLLVNATELTTPEDADALVAALKEVL