Protein Info for Rru_A3031 in Rhodospirillum rubrum S1H

Annotation: 2-phosphoglycolate phosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00702: Hydrolase" amino acids 18 to 201 (184 residues), 113.4 bits, see alignment E=3.6e-36 PF13419: HAD_2" amino acids 20 to 206 (187 residues), 104.1 bits, see alignment E=1.8e-33 PF12710: HAD" amino acids 20 to 198 (179 residues), 46.1 bits, see alignment E=1.6e-15 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 20 to 231 (212 residues), 202.1 bits, see alignment E=1.2e-63 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 90 to 206 (117 residues), 36.1 bits, see alignment E=1.1e-12 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 122 to 201 (80 residues), 33.8 bits, see alignment E=6.2e-12 PF13242: Hydrolase_like" amino acids 163 to 216 (54 residues), 38 bits, see alignment E=2.5e-13

Best Hits

Swiss-Prot: 100% identical to GPH_RHORT: Phosphoglycolate phosphatase (cbbZ) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to rru:Rru_A3031)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPW9 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Rru_A3031 2-phosphoglycolate phosphatase (NCBI) (Rhodospirillum rubrum S1H)
MSASVHPPPPPRPFPLPKAVIFDLDGTLVHSLPGLTDALNKTLAEDDLAPLDEAAVKRMV
GEGAGLLVARAFAAYGLGRADDADDTATQARLARFLAHYAPDPLAGASVYPGALALLGAL
AARGIRLGVCTNKPEGPARALLEGLGLADPIMDVVGGDTLAQRKPDPAPLRALLDSLGVE
ADQALMVGDSPTDVATAKAAGVPVVVMSYGYSREPVASLGALAVFDDFASLGDWLGFPQP
GGDRLGATPALSENPA