Protein Info for Rru_A3030 in Rhodospirillum rubrum S1H

Annotation: UDP-N-acetylglucosamine pyrophosphorylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF01128: IspD" amino acids 35 to 159 (125 residues), 41.2 bits, see alignment E=4.1e-14 TIGR01173: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase" amino acids 35 to 465 (431 residues), 482.7 bits, see alignment E=5.8e-149 PF12804: NTP_transf_3" amino acids 36 to 169 (134 residues), 75.3 bits, see alignment E=1.6e-24 PF00483: NTP_transferase" amino acids 36 to 178 (143 residues), 30.7 bits, see alignment E=6.1e-11 PF00132: Hexapep" amino acids 294 to 329 (36 residues), 33.8 bits, see alignment 4.9e-12 amino acids 406 to 440 (35 residues), 34.2 bits, see alignment 3.5e-12

Best Hits

Swiss-Prot: 100% identical to GLMU_RHORT: Bifunctional protein GlmU (glmU) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K04042, bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC: 2.3.1.157 2.7.7.23] (inferred from 100% identity to rru:Rru_A3030)

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPX0 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Rru_A3030 UDP-N-acetylglucosamine pyrophosphorylase (NCBI) (Rhodospirillum rubrum S1H)
MIAAVPPPIVAAPALPAADPDPATITAGFPMTKTAAVILAAGQGTRMKSALPKVLHPLAG
RPMVAHLIHALGAVAPSRTVVVIGPGMESVADRVAPLPTVLQAERLGTAHAVAQAGEALA
GFDGTVLILYGDTPLITPETLTRMVEARLAAEDPAVVVLGFRPADPLQYGRLITSPAGLE
AIVEYKDATAEQRAIGLCNSGVMAVDGRVLFALLAAVGNDNAKGEYYLTDIVALARGMGR
ACAVVEGAAEELLGVNSRSELAAAEAVIQGRLREKAMEGGATLTAPETVFFSADTRLGRD
VSIGPFVTFGPGVEIGDGVEIKGFCHIEGARVAAKATLGPYARLRPGATIAEGAHVGNFV
EIKNSAVEQGAKVNHLTYIGDARVGARANIGAGTITCNYDGFGKYHTDIGEGAFIGSNTA
LVAPVSIGAGAIIGAGSTIARDVEADALALTRGPHEVRPGWAAKFRAHMRRLTGKN