Protein Info for Rru_A3013 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 151 to 176 (26 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 235 to 250 (16 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 104 to 277 (174 residues), 43.3 bits, see alignment E=1.8e-15

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to rru:Rru_A3013)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPY7 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Rru_A3013 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MEARSKPPVLTAGGRCSLPVLTLLLLGFVAPLVAVIAFSFAEPRSFAAFSSFTLANYREI
FDPANTVWMSFAWSLGLAGVTVALLGVITYPIALGLVRVFGRWAPVISILFVFPLFISEN
VRLYGWVLFFIKNGVLDGTLRLLGGSGPEVLYTPAATLFGMVYTYLPFMLFPTVLGLSLL
PRDVVDAARDLGASRLQAWWEVELPLAMPGILIGTLLTFVLAVGAVAESKIMGGQSLIVI
THDIEIAFTYSQNWPLGSALAVLLTLIIGGLTLFALSKLDLDRILGRK