Protein Info for Rru_A3010 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, DeoR family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF08220: HTH_DeoR" amino acids 19 to 71 (53 residues), 59 bits, see alignment E=7.9e-20 PF08279: HTH_11" amino acids 19 to 60 (42 residues), 34.4 bits, see alignment 4.2e-12 PF01047: MarR" amino acids 22 to 65 (44 residues), 24.7 bits, see alignment 4.3e-09 PF00392: GntR" amino acids 23 to 70 (48 residues), 32 bits, see alignment 2e-11 PF00455: DeoRC" amino acids 88 to 244 (157 residues), 121.4 bits, see alignment E=9.4e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3010)

Predicted SEED Role

"transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPZ0 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Rru_A3010 Transcriptional Regulator, DeoR family (NCBI) (Rhodospirillum rubrum S1H)
MSDNGASPAGSGKLSKAGRQERIVAELRAGPTLRVSELATTLGVSTETIRRDLDELEARG
LINRTYGGAVRPFGPEPTIRERHQMLVSEREIIAAAAARTISHGDVLIIGGGATTTHVAR
RLAAEKRDLKVFTDSFAVATVLAPNPTVEVFLCPGRYNGQEGCVSGAETIDYIGKIYANH
AILGATGLTEDGPNDADIDAAATYRAMALRATDVTVVADHTKFDRAAISVYCRWPVISRL
VTDQRPEGALRLILERAGVEVIVP