Protein Info for Rru_A2999 in Rhodospirillum rubrum S1H
Annotation: Radical SAM (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 41% identical to PFLA_HAEIN: Pyruvate formate-lyase 1-activating enzyme (pflA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 100% identity to rru:Rru_A2999)Predicted SEED Role
"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)
MetaCyc Pathways
- pyruvate fermentation to acetate IV (3/3 steps found)
- (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
- reductive monocarboxylic acid cycle (2/2 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
- pyruvate fermentation to ethanol I (2/3 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (6/9 steps found)
- mixed acid fermentation (11/16 steps found)
- superpathway of N-acetylneuraminate degradation (13/22 steps found)
Isozymes
Compare fitness of predicted isozymes for: 1.97.1.4
Use Curated BLAST to search for 1.97.1.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RQ01 at UniProt or InterPro
Protein Sequence (265 amino acids)
>Rru_A2999 Radical SAM (NCBI) (Rhodospirillum rubrum S1H) MFDLPAPLPQVPAEADLVSPPLQTRGFLHSVETGAAVDGPGMRFVFFLSGCQFRCAYCHN PDTWKLHNGRALDLDEAMAEVSPYAGFLRIAGGVTVSGGEPLMQADFTGALLARLKDQLG LHTALDTQGFLHAGVSDRWFDPVDLVLLDIKHSDPEAYHRLTGQALAPTLAFAHRLVDLG KPMWIRYVLVPGLTDGADDIDRLADFLACLGPAVQRVEVLPFHQMGAAKWARLGLTYSLA QTPTPTAPQVDAARARFAERGLKVF