Protein Info for Rru_A2985 in Rhodospirillum rubrum S1H
Annotation: Hydroxyneurosporene synthase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 42% identical to CRTC_RHOS4: Acyclic carotenoid 1,2-hydratase (crtC) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
KEGG orthology group: K09844, hydroxyneurosporene dehydrogenase (inferred from 100% identity to rru:Rru_A2985)Predicted SEED Role
"Hydroxyneurosporene dehydrogenase (EC 1.-.-.-)" in subsystem Carotenoids (EC 1.-.-.-)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RQ15 at UniProt or InterPro
Protein Sequence (253 amino acids)
>Rru_A2985 Hydroxyneurosporene synthase (NCBI) (Rhodospirillum rubrum S1H) MAINVALYNRRGGRWAMTERGREALVRDDSTLAIGPSALRWDGTALRITLNEISFPKPAR VRGEVVIHPEVRTTVPQVLDGAGRHVWWPFAPRSRVELRMDNPDIRWNGHGYFDFNCGSE PLQDAFSRWDWSRAPLADGGAALLYEVTPRQGADRLLSLRVDRDGALSAFSPPPKAPLGA TGWRVARGTRCDVGAPPTVLRTLEDTPFYARSLLSTRLAGEETRAVHESIDLDRLRAGWV WPLLPFRMPRRGG