Protein Info for Rru_A2985 in Rhodospirillum rubrum S1H

Annotation: Hydroxyneurosporene synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

Swiss-Prot: 42% identical to CRTC_RHOS4: Acyclic carotenoid 1,2-hydratase (crtC) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K09844, hydroxyneurosporene dehydrogenase (inferred from 100% identity to rru:Rru_A2985)

Predicted SEED Role

"Hydroxyneurosporene dehydrogenase (EC 1.-.-.-)" in subsystem Carotenoids (EC 1.-.-.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

See Q2RQ15 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Rru_A2985 Hydroxyneurosporene synthase (NCBI) (Rhodospirillum rubrum S1H)
MAINVALYNRRGGRWAMTERGREALVRDDSTLAIGPSALRWDGTALRITLNEISFPKPAR
VRGEVVIHPEVRTTVPQVLDGAGRHVWWPFAPRSRVELRMDNPDIRWNGHGYFDFNCGSE
PLQDAFSRWDWSRAPLADGGAALLYEVTPRQGADRLLSLRVDRDGALSAFSPPPKAPLGA
TGWRVARGTRCDVGAPPTVLRTLEDTPFYARSLLSTRLAGEETRAVHESIDLDRLRAGWV
WPLLPFRMPRRGG