Protein Info for Rru_A2974 in Rhodospirillum rubrum S1H

Annotation: Photosynthetic reaction centre M subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 50 to 76 (27 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 200 to 225 (26 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details TIGR01115: photosynthetic reaction center M subunit" amino acids 1 to 304 (304 residues), 550.6 bits, see alignment E=4.9e-170 PF00124: Photo_RC" amino acids 50 to 302 (253 residues), 366.8 bits, see alignment E=2.8e-114

Best Hits

Swiss-Prot: 100% identical to RCEM_RHORU: Reaction center protein M chain (pufM) from Rhodospirillum rubrum

KEGG orthology group: K08929, photosynthetic reaction center M subunit (inferred from 100% identity to rru:Rru_A2974)

Predicted SEED Role

"Photosynthetic reaction center M subunit" in subsystem Photosystem II-type photosynthetic reaction center

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ26 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Rru_A2974 Photosynthetic reaction centre M subunit (NCBI) (Rhodospirillum rubrum S1H)
MSEYQNILTGVQVRTAPHSAPIAKGIFPRLGKPGFSYWLGKIGDAQIGPIYLGTTGVLSL
VFGFFAIEIIGFNLLASVNWSPMEFGRQFFWLGLEPPAAEYGLGFAPLAEGGWWQIAGFF
LTTSILLWWVRMYRRARALKMGTHTAWAFASAIFLFLSLGFIRPLLMGNFSESVPFGIFP
HLEWTNSFSLNYGNFFYNPFHMLSIAFLYGSALLFAMHGATILAVSRLGGDREVEQITDR
GTAAERAALFWRWTMGFNATMESIHRWAWWFAVLCTFTGAIGILLTGTVVDNWFEWGVKH
GLAPAP