Protein Info for Rru_A2965 in Rhodospirillum rubrum S1H

Annotation: Riboflavin kinase / FAD synthetase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00083: riboflavin biosynthesis protein RibF" amino acids 18 to 310 (293 residues), 282 bits, see alignment E=2.8e-88 PF06574: FAD_syn" amino acids 18 to 166 (149 residues), 166.6 bits, see alignment E=4e-53 PF01687: Flavokinase" amino acids 185 to 310 (126 residues), 140.1 bits, see alignment E=4.5e-45

Best Hits

Swiss-Prot: 43% identical to RIBF_PSEFL: Bifunctional riboflavin kinase/FMN adenylyltransferase (ribF) from Pseudomonas fluorescens

KEGG orthology group: K11753, riboflavin kinase / FMN adenylyltransferase [EC: 2.7.1.26 2.7.7.2] (inferred from 100% identity to rru:Rru_A2965)

Predicted SEED Role

"Riboflavin kinase (EC 2.7.1.26) / FMN adenylyltransferase (EC 2.7.7.2)" in subsystem Riboflavin, FMN and FAD metabolism (EC 2.7.1.26, EC 2.7.7.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.26 or 2.7.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ35 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Rru_A2965 Riboflavin kinase / FAD synthetase (NCBI) (Rhodospirillum rubrum S1H)
MRILRHPYELPASLLGGSLALGNFDGVHRGHQRVIGSARAIAAQQGLPLGVMTFAPHPRR
FFQPDLPPFTLTSFRLKAHLISEEGADFLYVQAFDEALSKGSAEWFVTEVLVKGLHVAHV
VVGQDYAFGHRRQGTVSLLQKMALDLGFGVTAVAPVKDEGGAIYSSTRVRACLQEGDVTT
AAQILGHPWEVEGRVEHGDKRGRTIGFPTANLKLGDYQRPRAGVYAVTAGLDDGAQTRFR
PGVANFGRRPTFDNGDALLEVHLFDVSPDLYGRHLRVRFHDFLRPEQTFPGLEALKAQIG
QDAAQARALFGLPPAAP