Protein Info for Rru_A2959 in Rhodospirillum rubrum S1H

Annotation: Major facilitator superfamily MFS_1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 50 to 70 (21 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details amino acids 328 to 351 (24 residues), see Phobius details amino acids 366 to 375 (10 residues), see Phobius details amino acids 398 to 419 (22 residues), see Phobius details amino acids 440 to 462 (23 residues), see Phobius details amino acids 474 to 493 (20 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 409 (394 residues), 169.4 bits, see alignment E=1.1e-53 PF06609: TRI12" amino acids 21 to 185 (165 residues), 30.1 bits, see alignment E=1.9e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2959)

Predicted SEED Role

"Major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ40 at UniProt or InterPro

Protein Sequence (506 amino acids)

>Rru_A2959 Major facilitator superfamily MFS_1 (NCBI) (Rhodospirillum rubrum S1H)
MLHSTSSRNQVALSAVCLSALMFGLEISSVPTILPTLEQLFSADFRQLQWVMNAYTTAMT
ACLMAMGALADRFGRKRVFLAGQVVFGVASLACGLADSPSMLIGARALQGAAAAALLTCQ
IAVLSQQFRDGRERALAFGWWGVTFGVGLGFGPLIGGLTAVVLGWEWVFLVHVILAAVAV
ILIQVGVEESTDPHALRLDVAGMVTLSLAVFCLVYLITRGRMPGPGDISGLALAALGVAC
FSAFVVVETRVARPMFDFTAFRTTNFSGALLASAGMNFSFWPFIIYLPVYFQGVLGLDSL
DAGLCLLAYTLPPLLAPPIAERLLLHFGPQVVIPLGLVIIGCGFVLMRAAALGGDASWVD
MLPGCILAGSGLGLANTTATNTASAALPPERAGMASGMNMSASMIALAINIALMGFILLQ
GTQAGLERLLPAATGDELSLLAESVAAGGEAVAAGAGLPIALVRQSLVHGFDWVMLYGAG
GVWLFAAICKLVFGSAKRSGPAPCDR