Protein Info for Rru_A2952 in Rhodospirillum rubrum S1H

Annotation: Methyltransferase small (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF05175: MTS" amino acids 39 to 135 (97 residues), 36.4 bits, see alignment E=4.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2952)

Predicted SEED Role

"tRNA (adenine37-N(6))-methyltransferase TrmN6 (EC 2.1.1.223)" (EC 2.1.1.223)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.223

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ46 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Rru_A2952 Methyltransferase small (NCBI) (Rhodospirillum rubrum S1H)
MTQPPVATPAGAPAWREDGLLDGRLRLMQPVDGYKVAIDSVLLAAAVDAAPGAHVLDAGA
GTGAALLCLAARRPDLRVTGLELQALHAGLCHWSIELNALAGRARVMAGDLDRPPPELRA
TPFDAVMTNPPFTSAGTPPPDGGRARAMMEGMALERWVARCLALLRPKGRFFAVHRADRL
DDLISALTGRAGEITVLPLWSRAGRPAERVIVAARKGVRGGARLLPGLVLHQADATAYTD
ETTALLRSGKALDLDPLGRL