Protein Info for Rru_A2944 in Rhodospirillum rubrum S1H

Annotation: ArgK protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 134 to 152 (19 residues), see Phobius details PF03308: MeaB" amino acids 31 to 288 (258 residues), 243 bits, see alignment E=7.6e-76 PF02492: cobW" amino acids 62 to 213 (152 residues), 21.9 bits, see alignment E=3e-08

Best Hits

KEGG orthology group: K07588, LAO/AO transport system kinase [EC: 2.7.-.-] (inferred from 100% identity to rru:Rru_A2944)

Predicted SEED Role

"putative periplasmic protein kinase ArgK and related GTPases of G3E family"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-

Use Curated BLAST to search for 2.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ54 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Rru_A2944 ArgK protein (NCBI) (Rhodospirillum rubrum S1H)
MSASLTPGRAAAPAEAADRLGLLRAGGKAALARALAGLETAPDALETTTLLAQAHAAPRA
RVIGITGPPGVGKSTLVNGLITHWRAAGKTVGVIAIDPSSRRSGGALLGDRTRLSVDPED
RGVFVRSMAARDHLGGLAGLTVAAMVLMRALFDVVLIETVGVGQSETEVSRVVDTVVFCV
QPGSGDSLQYMKAGIAEIPHLVVVTKADMTREAMRARADVEGALSLSDAEDDWTAQVLMV
SARMGDGVDALARAIDEHGAYLAKGDRIRALRHLQAEGWLKDSVRERFGREGLRKAGPLA
LAPGESPFDRLAVLARELA