Protein Info for Rru_A2906 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, AsnC family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 61 to 81 (21 residues), see Phobius details PF13404: HTH_AsnC-type" amino acids 13 to 54 (42 residues), 65 bits, see alignment E=6.6e-22 PF13412: HTH_24" amino acids 13 to 60 (48 residues), 74.6 bits, see alignment E=5.6e-25 PF01037: AsnC_trans_reg" amino acids 79 to 153 (75 residues), 86.1 bits, see alignment E=1.8e-28

Best Hits

Swiss-Prot: 44% identical to BKDR_PSEPU: Bkd operon transcriptional regulator (bkdR) from Pseudomonas putida

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 100% identity to rru:Rru_A2906)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ92 at UniProt or InterPro

Protein Sequence (168 amino acids)

>Rru_A2906 Transcriptional Regulator, AsnC family (NCBI) (Rhodospirillum rubrum S1H)
MPQPHAPATPRSLDAIDRKILAELRANARLTMNDLAERVGLSSSPCWSRVKRLEESGAIR
GYVAVLDAAALGLEIIVFIEVTLDKHDDKALDRFGDALSAMPEVLESYLVTGDYDYLVKL
AVASTHHYEQFLREKLYRIQGIRHTRSTFALRELKRLLSVDPLTLPYP