Protein Info for Rru_A2905 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF6, transmembrane (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 269 to 293 (25 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details PF00892: EamA" amino acids 32 to 164 (133 residues), 58.6 bits, see alignment E=4.4e-20 amino acids 180 to 315 (136 residues), 49 bits, see alignment E=4e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2905)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ93 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Rru_A2905 Protein of unknown function DUF6, transmembrane (NCBI) (Rhodospirillum rubrum S1H)
MAAKTMDFAGPAVSTGLGGLGPTRVSGAALMATLLFLGAPLLFAGNMLAARMMQGVLPPF
TLASARWALAALVLLPFVRRELFGQRRAAPGRWRALVLPAVLGGALSVGPQYWAAHFTSA
GNIALVFAMTPLLVALLDRLAGGARLGAPALAGMGLAIAGIATASFQGSLARLLAFQINP
GDLLAGLAALAWAGYTVATRRPRAGLSGLALLWGVAAGGALTLAPAAAVEWLVLGVPSLS
REAVLGVAFLAIVPSIGAYLAYGRLIGLVGPVVAGTSMYLIPLYALALGAMVLGEALGRY
HLAAAALVIGGVALSRWRGAAKVCG