Protein Info for Rru_A2896 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, AsnC family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF13412: HTH_24" amino acids 8 to 55 (48 residues), 67.8 bits, see alignment E=7.4e-23 PF13404: HTH_AsnC-type" amino acids 8 to 49 (42 residues), 58.5 bits, see alignment E=6.6e-20 PF01037: AsnC_trans_reg" amino acids 76 to 148 (73 residues), 72.4 bits, see alignment E=3.4e-24

Best Hits

Swiss-Prot: 56% identical to LRP_RHIME: Leucine-responsive regulatory protein (lrp) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2896)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQA2 at UniProt or InterPro

Protein Sequence (164 amino acids)

>Rru_A2896 Transcriptional Regulator, AsnC family (NCBI) (Rhodospirillum rubrum S1H)
MATQRVKLDRIDRRILNDLQSDGRMTNVDLAKRAGISAPPCLRRVRALEEAGFIRGYHAD
LDAVSLGYNVTVFAHVGLNSQAESDLRAFEDLVASWPEVRECHMLAGETDFLLKVVARDW
DDYQRFLTSRLTPAPNVGHVKSALAIRTGKLQPGVPVAETDPDD