Protein Info for Rru_A2893 in Rhodospirillum rubrum S1H

Annotation: ABC-3 transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 55 to 82 (28 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 174 to 191 (18 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details PF00950: ABC-3" amino acids 11 to 265 (255 residues), 265.9 bits, see alignment E=4e-83 PF01032: FecCD" amino acids 64 to 260 (197 residues), 33.1 bits, see alignment E=3.3e-12

Best Hits

Swiss-Prot: 65% identical to YFEC_YERPE: Chelated iron transport system membrane protein YfeC (yfeC) from Yersinia pestis

KEGG orthology group: K11605, manganese/iron transport system permease protein (inferred from 100% identity to rru:Rru_A2893)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitC" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQA5 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Rru_A2893 ABC-3 transporter component (NCBI) (Rhodospirillum rubrum S1H)
MMALLAQPFAYDYMINAMWVSALVGGVCAFLSCFLMLKGWSLIGDALSHAIVPGVAGAAI
IGLPFSVGAFLAGGLAAGAMLFLNRRTRLKEDAIIGLIFTSFLGLGLFMISLDPASVNVQ
TIVLGNILAITRGDTLQLVLISGISLAVLLAKWKDLMVAFFDESHARSVGLNPALLKGVF
FTLLSACTVAALQTVGAFLVIAMVVTPGATAYLLTDRFPRLIVLSVGLGVLSCLIGTYLS
FFLDGATGGVIVVLQTLVFLLAFLFAPKHGLLAARLRGRRMREAGR