Protein Info for Rru_A2887 in Rhodospirillum rubrum S1H

Annotation: GreA/GreB family elongation factor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF03449: GreA_GreB_N" amino acids 4 to 74 (71 residues), 110.5 bits, see alignment E=3.6e-36 TIGR01462: transcription elongation factor GreA" amino acids 5 to 154 (150 residues), 201.3 bits, see alignment E=4.3e-64 PF01272: GreA_GreB" amino acids 82 to 155 (74 residues), 102.1 bits, see alignment E=1.3e-33

Best Hits

Swiss-Prot: 100% identical to GREA_RHORT: Transcription elongation factor GreA (greA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03624, transcription elongation factor GreA (inferred from 100% identity to rru:Rru_A2887)

Predicted SEED Role

"Transcription elongation factor GreA" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQB1 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Rru_A2887 GreA/GreB family elongation factor (NCBI) (Rhodospirillum rubrum S1H)
MEKIPMTPDGLARLEAELKSLKSVDRPAVIRAISEARDHGDLSENAEYHAARERQSFIEG
RIKELEDVTSRAEVIDISKLSGDTVRFGATVSVLDEDSEEQTTYQIVGAHEADLKAGRIS
VASPIGKALIGKKVGDSIEVKAPGGSKFYEVTMVRFG