Protein Info for Rru_A2877 in Rhodospirillum rubrum S1H

Annotation: Threonine dehydratase II (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00291: PALP" amino acids 31 to 315 (285 residues), 247.3 bits, see alignment E=3.4e-77 TIGR01127: threonine ammonia-lyase" amino acids 35 to 408 (374 residues), 423.9 bits, see alignment E=2.9e-131 PF13291: ACT_4" amino acids 338 to 404 (67 residues), 27.3 bits, see alignment E=7.1e-10 PF01842: ACT" amino acids 340 to 406 (67 residues), 28.4 bits, see alignment E=1.7e-10

Best Hits

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 100% identity to rru:Rru_A2877)

Predicted SEED Role

"Threonine dehydratase (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis or Threonine degradation (EC 4.3.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQC1 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Rru_A2877 Threonine dehydratase  II (NCBI) (Rhodospirillum rubrum S1H)
MSPFPPFPAASAVPAVTLADVEAAARLIAHAVPHTPLLPSRTLSRLTGAEVFIKFENHQF
TASFKERGALNRLSALSETERARGVIAMSAGNHAQGVAYHAQRLGIPAVIVMPADTPFVK
VKHTRDFGARVVLEGETVAESRLVAERIREEEGLTFVHPYNDPWVIAGQGTVALEMLADQ
PDLDILVAPIGGGGLLGGMAVAAKAVKPAIEMIGVQVGLYPSAYNALHGLPPCTGGATVA
EGIAVKEPGDLTLPLLRALVSRIILVDETAVEEAISLYLSVEKTVAEGAGAASLAALLTE
PQRFRGKKVGLVLSGGNIDPRIMASVIMRSLVREGRIAHLSIRIGDKPGQLARVATVIGE
TGGNIVEVRHERLTSDISVKSTDLRVILETRDHTHLAEILERLAAAGFPANERSFSGPAA
GD