Protein Info for Rru_A2870 in Rhodospirillum rubrum S1H

Annotation: integral membrane protein TerC (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details PF03741: TerC" amino acids 17 to 205 (189 residues), 158 bits, see alignment E=3.1e-50 PF00571: CBS" amino acids 373 to 422 (50 residues), 26.1 bits, see alignment 1.3e-09 PF03471: CorC_HlyC" amino acids 438 to 514 (77 residues), 68.5 bits, see alignment E=6.4e-23

Best Hits

Swiss-Prot: 50% identical to YEGH_ECOLI: UPF0053 protein YegH (yegH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2870)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQC8 at UniProt or InterPro

Protein Sequence (522 amino acids)

>Rru_A2870 integral membrane protein TerC (NCBI) (Rhodospirillum rubrum S1H)
MMFEWIADPSAWVGLATLVLLEIVLGIDNLVFIAILADKLPPSQRNKARLLGLSLALIMR
LGLLASISWIVTLTQPLFTVYGFGFSGRDLILLIGGLFLMFKGTMELHERLEGAEGPKEG
KVVHAVFWQVIVQIVVLDAVFSLDSVITAVGMISHLSVMMIAVVVAMAVMMAASKPLMAF
VSRHPTVVILCLGFLMMIGFSLIVEGFGFHIPKGYLYAAIGFSILIEAFNQVARRNRERI
TSTSDLRERTANAVLSLIGGRSAEQGLGETADVVADRGAVKQIFAPEEKDMIHGVLTLAE
RPVKSIMTPRPDIDWLDLDSPKDELRAEILSMGHSRFLLAHGSLDQFIGVALARDLMRDL
MEEGQINLERSVRQPLVVHESVKVLRLMEQLRQSPLQVAVVLDEYGSLEGIATPTDILEA
IAGEFPDEDEDYVTVERGEDGSWLVEGWLDIRRISNIIGVDLVDEADRYSTLAGYILWQL
GHLPTEGERVIKGDLVVEVVSMQGRSIDKVRLHFENTDGEGA