Protein Info for Rru_A2864 in Rhodospirillum rubrum S1H

Annotation: Predicted signal transduction protein containing EFhand domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF13202: EF-hand_5" amino acids 19 to 39 (21 residues), 13.9 bits, see alignment (E = 9.1e-06) amino acids 56 to 78 (23 residues), 27.7 bits, see alignment (E = 3.9e-10) amino acids 105 to 127 (23 residues), 18.4 bits, see alignment (E = 3.5e-07) amino acids 171 to 184 (14 residues), 12.3 bits, see alignment (E = 3.1e-05) PF13499: EF-hand_7" amino acids 21 to 79 (59 residues), 31.5 bits, see alignment E=5.5e-11 amino acids 58 to 128 (71 residues), 39.6 bits, see alignment E=1.6e-13 amino acids 104 to 184 (81 residues), 31 bits, see alignment E=7.8e-11 PF13833: EF-hand_8" amino acids 95 to 125 (31 residues), 17.1 bits, see alignment 1.1e-06

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2864)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQD4 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Rru_A2864 Predicted signal transduction protein containing EFhand domain (NCBI) (Rhodospirillum rubrum S1H)
MSIDTSYSSTSMTDYALIRAQLFQKTDTDSSGGVSLEELTAKGQTLPTGKNSQSTEDLFK
QVDTDSSGEISLEELENFASASLASQTSGSLLQAQEETATTPATLKELFNTLDSDDDNTI
SLEEFEAGASTAQATATQASAAGGGGGGGGGGGGGVSAASSSDEEEETYDSLDTNKDGVV
SASERAAAAPPPRPVETGSGADNASDENASADQNASSTTAQAATTAQSAADDAVATEKAT
KITELLRRTLTAYGNTTSNGAVTGSAGIFA