Protein Info for Rru_A2849 in Rhodospirillum rubrum S1H

Annotation: Flagellar P-ring protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF02119: FlgI" amino acids 39 to 382 (344 residues), 462 bits, see alignment E=5.3e-143

Best Hits

Swiss-Prot: 100% identical to FLGI_RHORT: Flagellar P-ring protein (flgI) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02394, flagellar P-ring protein precursor FlgI (inferred from 100% identity to rru:Rru_A2849)

Predicted SEED Role

"Flagellar P-ring protein FlgI" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQE9 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Rru_A2849 Flagellar P-ring protein (NCBI) (Rhodospirillum rubrum S1H)
MTSTMTAPAGFLPRVGRLIAVALTAVFLLAPTGAEAASRIKDLADFEGVRDNILVGYGLV
VGLKGTGDKLDDVTFTKESLIGMLERLGVNTREGKLDPDNVAAVMVTGTLPPFARQGSRI
DVTISALGTAKSLAGGTLMVTPLIGADGEVYAVAQGQAQIGGYAVQGQSASVQKGVPTSG
RIPNGALVEAEVPFNLSAMESVKISLRNPDFTTARRIAQAINAFLGTELARPLDPGTVLV
AVTAGYEGNAVALLTDIEQLLVEPDTVARVVIDEATGTIVIGEKVRINTVAIAQGNLTIR
VTETPQVSQPAPFSQGGQTAVVPRTNIQVDEGKDNKLTVVNGGVNLQDLVNSLNALGVGP
RDMISILQAIKSAGAMQAEIQVM