Protein Info for Rru_A2831 in Rhodospirillum rubrum S1H

Annotation: Acyltransferase 3 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 308 to 331 (24 residues), see Phobius details amino acids 344 to 368 (25 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 23 to 366 (344 residues), 101.7 bits, see alignment E=2.2e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2831)

Predicted SEED Role

"putative macrolide O-acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQG7 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Rru_A2831 Acyltransferase 3 (NCBI) (Rhodospirillum rubrum S1H)
MLISDSRNAGGRRGGSDGPVKVDYIDAVRGWAILLVITCHVGGAFPELPTPVKHITNFGW
HGVQMFFLASAVTLMMSWQGRHERYGTACKNFMIRRFLRIAPMYYTGALLYFVFDPPASG
FDFSQLLIALSFINSWHPVWTPTVDDAWMVVPGGWSIGVEFTFYMLFPLVVLVITSARRA
LGALVVLIVLAILANVYGKIAFADYPPRAVSNFLYFWFPNQAPIFCCGILLFFLIKRGSG
QAPLSPALTYGLIALSGLIYVVVAEVVRGTHYFNPFGVPPLALATLAFMIFILALAKGSP
TLFSHGALRQLGTLSFSCYVLHFLVLETLPGLTAGLIDTQATGFAAIGMFALLWAATLGA
TVGAAFLAHRLIEQPGIALARRLTARGRRAKPVKALPEGVV