Protein Info for Rru_A2825 in Rhodospirillum rubrum S1H

Annotation: Flagellar basal-body rod protein FlgC (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 TIGR01395: flagellar basal-body rod protein FlgC" amino acids 9 to 136 (128 residues), 144.6 bits, see alignment E=1.2e-46 PF06429: Flg_bbr_C" amino acids 90 to 133 (44 residues), 51.5 bits, see alignment E=3e-18

Best Hits

Swiss-Prot: 47% identical to FLGC_AGRFC: Flagellar basal-body rod protein FlgC (flgC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02388, flagellar basal-body rod protein FlgC (inferred from 100% identity to rru:Rru_A2825)

Predicted SEED Role

"Flagellar basal-body rod protein FlgC" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQH3 at UniProt or InterPro

Protein Sequence (137 amino acids)

>Rru_A2825 Flagellar basal-body rod protein FlgC (NCBI) (Rhodospirillum rubrum S1H)
MDELKQTAAIATSGLKAQTERLRTIAQNMANADSMAERQGEDPYRRRVVTFKSVMDREVG
AEMVRTGRVREDMSAFTRKYDPSHPGADAEGYVLAPNVNPMVEMMDMREAQRSYEANLNV
ITATREMTRNTLELLRS