Protein Info for Rru_A2821 in Rhodospirillum rubrum S1H

Annotation: Flagellar biosynthetic protein FlhB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 89 to 116 (28 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 186 to 211 (26 residues), see Phobius details TIGR00328: flagellar biosynthetic protein FlhB" amino acids 7 to 353 (347 residues), 395.3 bits, see alignment E=1.3e-122 PF01312: Bac_export_2" amino acids 8 to 347 (340 residues), 404.9 bits, see alignment E=1.5e-125

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 100% identity to rru:Rru_A2821)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQH7 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Rru_A2821 Flagellar biosynthetic protein FlhB (NCBI) (Rhodospirillum rubrum S1H)
MADDDKDSKTEDPSSRKLGKAREDGQVAQSQEVKSFLMLGGALFMVAVMGGWIADKVALR
VRVFLEQPDTFHLDAVGLRDLLARLLLDIGLVLAMPIAMFIVLAILGGVGQFGLIFSAKK
ITPELQKISPLAGFKRLFSVRALVEGVKGIVKVVVVSAIVAALMLPRLRTPELFMDQDIL
VTLGQIHRLLVVLLISVVTIVGAIAAADFAFQKYKHIEELKMTKQEVKDEHKNAEGDPQI
KSKIRQLRMRRARERMMARVPEASVVITNPTHFAVALKYDMDMMSAPVLVAKGQDFIALK
IREVAEENEVPIVENPPLARALFAAVEIDHEIPPDHYKAVAEVIGYVMRLKKATKR