Protein Info for Rru_A2813 in Rhodospirillum rubrum S1H

Annotation: Molybdopterin cofactor biosynthesis MoaC region (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 TIGR00581: molybdenum cofactor biosynthesis protein C" amino acids 12 to 160 (149 residues), 208.1 bits, see alignment E=2.7e-66 PF01967: MoaC" amino acids 23 to 158 (136 residues), 194.8 bits, see alignment E=3e-62

Best Hits

Swiss-Prot: 100% identical to MOAC_RHORT: Cyclic pyranopterin monophosphate synthase (moaC) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 100% identity to rru:Rru_A2813)

MetaCyc: 60% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQI5 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Rru_A2813 Molybdopterin cofactor biosynthesis MoaC region (NCBI) (Rhodospirillum rubrum S1H)
MTDPAPATADGLTHFDTAGNAVMVDVSAKDETERVAVAGGCVEMAPATLRAIIERGLKKG
DVLSVAQLAGIMGAKRTPDLIPLCHPLALTKVAVELTPDPDHDRVVITATCALRGRTGVE
MEALTAVAVAGLTVYDMCKAVDKGMRLTDIRLLSKTGGKSGTWTAS