Protein Info for Rru_A2801 in Rhodospirillum rubrum S1H

Annotation: thiol-disulfide interchange protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF08534: Redoxin" amino acids 18 to 142 (125 residues), 82.4 bits, see alignment E=6.1e-27 PF00578: AhpC-TSA" amino acids 19 to 134 (116 residues), 76.3 bits, see alignment E=4.2e-25 PF13905: Thioredoxin_8" amino acids 42 to 132 (91 residues), 33.3 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2801)

Predicted SEED Role

"Possible periplasmic thiredoxin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQJ7 at UniProt or InterPro

Protein Sequence (153 amino acids)

>Rru_A2801 thiol-disulfide interchange protein (NCBI) (Rhodospirillum rubrum S1H)
MALVLGLAACKPEEAGRAGAKAPDLAALTLEGTPTSLRDHAGRVVVVNFWLGGCAPCLTE
MPALEAFHRGWADKGVDLMAINVGGNAQIVRKAITDVDATFPFLVDELSLTASRYEVAVF
PTTLVIDRQGIVRARFAGEMKDQVLAQAVLPLL