Protein Info for Rru_A2794 in Rhodospirillum rubrum S1H

Annotation: Deoxycytidine triphosphate deaminase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 3 to 188 (186 residues), 190 bits, E=1.6e-60
• PF06559: DCD
  • amino acids 3 to 161 (159 residues), 23.1 bits, E=2.9e-09
• PF00692: dUTPase
  • amino acids 78 to 168 (91 residues), 33 bits, E=4.4e-12

Best Hits

Swiss-Prot: 100% identical to DCD_RHORT: dCTP deaminase (dcd) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 100% identity to rru:Rru_A2794)

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (11/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

See Q2RQK4 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Rru_A2794 Deoxycytidine triphosphate deaminase (NCBI) (Rhodospirillum rubrum S1H)
MKLSDTDIRRYMAEGRIAIDPVPGEDAIGAMSVDLQLGDSFRVFVPGKVSHVDLAPPGGI
KGRDIEALMGHVEVGENEAFYLHPGEFALGITIQRVRLPADVAGRLDGRSSLARLGLMVH
ATAHTIDPGWDGRITLEFFNCGPLPLAMRPGMRICAISFEALMSPTSKPYAASPTAKYKD
QLAPLPSRLASDQSA