Protein Info for Rru_A2787 in Rhodospirillum rubrum S1H

Annotation: inner-membrane translocator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 249 to 266 (18 residues), see Phobius details amino acids 278 to 295 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 15 to 265 (251 residues), 120.3 bits, see alignment E=4.4e-39

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to rru:Rru_A2787)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQL1 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Rru_A2787 inner-membrane translocator (NCBI) (Rhodospirillum rubrum S1H)
MDLLDLLLSAGLWATVLRIATPLIFGTLGELLCERAGVLNLGIEGIMTLGALVGWLSVYQ
GCDLWTGVMLAACAGMAAGLLQGLLTVPLGLSQHVTGIGVTLLCTSLSYYVYRLALPQTT
TPPSIAPFAPFGDGALADLPVIGGVLAQQTPLTMVALCAVVAIAWLLYRTPLGLAIRMVG
ENPAAADAQGISVTAVRMGAVMAGSALMAVGGAFLTLSAFNAFFFNMIGGRGWICIALVV
FASWRPGKALFGALLFALFDALQTRLQQGGDSGIPYQVYLMAPYVLSIVALVVMSRRAAY
PQALMIPFRKGER