Protein Info for Rru_A2779 in Rhodospirillum rubrum S1H

Annotation: Plasmid maintenance system antidote protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 TIGR02607: addiction module antidote protein, HigA family" amino acids 10 to 89 (80 residues), 96.4 bits, see alignment E=3.5e-32 PF01381: HTH_3" amino acids 22 to 74 (53 residues), 42.4 bits, see alignment E=5.8e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2779)

Predicted SEED Role

"HigA protein (antitoxin to HigB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQL9 at UniProt or InterPro

Protein Sequence (110 amino acids)

>Rru_A2779 Plasmid maintenance system antidote protein (NCBI) (Rhodospirillum rubrum S1H)
MSEALGLRVKNPAHPGGFVKSEIIEALGLSVTSAAQVLGVTRAALSAVLNERAHLSPEMA
LRIEKAFGVSMDTLMRMQNSYDIAQARKREGEITVAPFQGKPQDRQATPI