Protein Info for Rru_A2772 in Rhodospirillum rubrum S1H

Annotation: ATP phosphoribosyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00070: ATP phosphoribosyltransferase
  • amino acids 12 to 199 (188 residues), 180 bits, E=2.1e-57
• PF01634: HisG
  • amino acids 63 to 219 (157 residues), 163.1 bits, E=2.6e-52

Best Hits

Swiss-Prot: 100% identical to HIS1_RHORT: ATP phosphoribosyltransferase (hisG) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 100% identity to rru:Rru_A2772)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.17

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

See Q2RQM6 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Rru_A2772 ATP phosphoribosyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MVFDARDGADKLVIALPKGRILKEAMPLIEAAGLSPEPSFDDPDSRQLRFSTSDPRVDII
RVRSFDVATFVAFGAAHIGVAGNDVILEFNYPELYAPLDLGIGACRLSVAEAERFSAEDD
PGRWSHIRVATKYPEITRRHFAARGVQAECIKLNGAMELAPALGLCRRIVDLVSSGATLK
ANGLVEVERILDVTSRLVVNRTAMKVRSREMTAWIERFREACDAVAA